Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Rabbit Polyclonal HSP60 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against APE1
| Applications | Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal HSP60 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Rat
Antibody Hosts
- Rabbit
Families
- Stem cell - Pluripotency
Filter by
Target Symbol
- PAK1 (21)
- P53 (19)
- HSP60 (15)
- C-MYC (14)
- CHK2 (14)
- HDAC1 (13)
- HSP90AB1 (13)
- CHK1 (12)
- LCK (12)
- VASP (12)
- CDK1 (11)
- PAXILLIN (11)
- HDAC2 (10)
- SOCS1 (10)
- CASPASE-6 (9)
- CYCLIN B1 (9)
- CASPASE 9 (8)
- CYCLIN D1 (8)
- HMG1 (7)
- PCNA (7)
- SP1 (7)
- ACTIN (6)
- BCL2 (6)
- CARDIAC TROPONIN I (6)
- NUCLEOPHOSMIN (6)
- OCT4 (6)
- UNG (6)
- ANNEXIN A2 (5)
- BIRC5 (5)
- CD117 (5)
- CTBP2 (5)
- GRP75 (5)
- PAK3 (5)
- PARP1 (5)
- PHAP1 (5)
- SUMO 1 (5)
- APE1 (4)
- AURORA A (4)
- CPN10 (4)
- CYCLIN A2 (4)
- GEMIN 2 (4)
- HMGA1 (4)
- HSC70 (4)
- IKB BETA (4)
- MCM5 (4)
- PROFILIN 1 (4)
- RPA34 (4)
- SHP1 (4)
- AIMP2 (3)
- APOLIPOPROTEIN E (3)
- COPS3 (3)
- DNMT3B (3)
- ERBB 3 (3)
- GTF2H2 (3)
- HPRT (3)
- HSP105 (3)
- MRE11 (3)
- MYH (3)
- PIAS2 (3)
- PROHIBITIN (3)
- PROTHYMOSIN, ALPHA (3)
- RAD51 (3)
- RFC2 (3)
- RFC3 (3)
- STXBP2 (3)
- THYMIDINE KINASE 1 (3)
- AATF (2)
- APC1 (2)
- ATIC (2)
- AURORA B (2)
- CXADR (2)
- CYCLIN E1 (2)
- DAXX (2)
- EWSR1 (2)
- GOT2 (2)
- HNRNP Q (2)
- KAT7 (2)
- KPNA2 (2)
- MCM2 (2)
- MCM3 (2)
- MCM6 (2)
- NM23A (2)
- PASK (2)
- POLD1 (2)
- PRMT5 (2)
- PROTEASOME SUBUNIT ALPHA TYPE 6 (2)
- PSMD11 (2)
- RFC4 (2)
- SSB (2)
- STIP1 (2)
- TRIP13 (2)
- WEE1 (2)
- ALPHA TUBULIN (1)
- ANNEXIN A3 (1)
- ARL4 (1)
- ARMC6 (1)
- B MYB (1)
- BAK (1)
- BAT3 (1)
- BNP (1)
Applications
Clonalities
Conjugates
Modifications
Assay Types
Pathways
- Cell cycle (140)
- Pathways in cancer (116)
- p53 signaling pathway (86)
- Chronic myeloid leukemia (69)
- Focal adhesion (63)
- Colorectal cancer (62)
- MAPK signaling pathway (61)
- Small cell lung cancer (60)
- Huntington's disease (57)
- Prostate cancer (56)
- Endometrial cancer (49)
- T cell receptor signaling pathway (46)
- Wnt signaling pathway (46)
- ErbB signaling pathway (43)
- Apoptosis (42)
- Bladder cancer (41)
- Progesterone-mediated oocyte maturation (41)
- Regulation of actin cytoskeleton (41)
- Thyroid cancer (41)
- Jak-STAT signaling pathway (39)
- Pancreatic cancer (38)
- Base excision repair (37)
- Natural killer cell mediated cytotoxicity (37)
- Chemokine signaling pathway (36)
- Amyotrophic lateral sclerosis (ALS) (35)
- Non-small cell lung cancer (35)
- DNA replication (33)
- Fc gamma R-mediated phagocytosis (33)
- Oocyte meiosis (30)
- Neurotrophin signaling pathway (29)
- Notch signaling pathway (28)
- Acute myeloid leukemia (27)
- Glioma (27)
- Melanoma (27)
- Axon guidance (26)
- Nucleotide excision repair (26)
- Renal cell carcinoma (26)
- Mismatch repair (24)
- Leukocyte transendothelial migration (23)
- Metabolic pathways (23)
- Epithelial cell signaling in Helicobacter pylori infection (21)
- RNA degradation (21)
- TGF-beta signaling pathway (21)
- Basal cell carcinoma (19)
- VEGF signaling pathway (19)
- Antigen processing and presentation (18)
- Primary immunodeficiency (18)
- Viral myocarditis (18)
- NOD-like receptor signaling pathway (17)
- Type I diabetes mellitus (15)
- Ubiquitin mediated proteolysis (15)
- Homologous recombination (14)
- Gap junction (13)
- Endocytosis (12)
- Alzheimer's disease (11)
- Insulin signaling pathway (11)
- Purine metabolism (10)
- Type II diabetes mellitus (10)
- Pyrimidine metabolism (9)
- B cell receptor signaling pathway (8)
- Parkinson's disease (8)
- Drug metabolism - other enzymes (7)
- Spliceosome (7)
- Cardiac muscle contraction (6)
- Dilated cardiomyopathy (6)
- Hypertrophic cardiomyopathy (HCM) (6)
- Non-homologous end-joining (6)
- Proteasome (6)
- Cysteine and methionine metabolism (5)
- Cytokine-cytokine receptor interaction (5)
- Hematopoietic cell lineage (5)
- Melanogenesis (5)
- Adherens junction (4)
- Adipocytokine signaling pathway (4)
- Cytosolic DNA-sensing pathway (4)
- RIG-I-like receptor signaling pathway (4)
- Basal transcription factors (3)
- Calcium signaling pathway (3)
- Alanine (2)
- Arginine and proline metabolism (2)
- One carbon pool by folate (2)
- Pathogenic Escherichia coli infection (2)
- Phenylalanine (2)
- Phenylalanine metabolism (2)
- Prion diseases (2)
- SNARE interactions in vesicular transport (2)
- Systemic lupus erythematosus (2)
- Tyrosine metabolism (2)
- aspartate and glutamate metabolism (2)
- tyrosine and tryptophan biosynthesis (2)
- ECM-receptor interaction (1)
- Fructose and mannose metabolism (1)
- Glycine (1)
- Glycolysis / Gluconeogenesis (1)
- Pentose phosphate pathway (1)
- Selenoamino acid metabolism (1)
- Steroid biosynthesis (1)
- serine and threonine metabolism (1)