Anti-TRPV4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Anti-TRPV4 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Rabbit Polyclonal Anti-TRPV4 Antibody
| Applications | IHC, WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
TRPV4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rat, Gibbon, Hamster, Horse (Predicted: Rabbit, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
Germany
Japan
United Kingdom
China
