Germany
Japan
United Kingdom
China
Antibodies
View as table Download
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Gli1 Antibody
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made toward the C-terminus portion of the human Gli1 protein (between residues 800-850) [UniProt P08151] |
Rabbit Polyclonal Wnt-5a Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Families
- Cancer stem cells
Pathways
- Basal cell carcinoma