Antibodies

View as table Download

Rabbit polyclonal anti-ACTB(beta Actin) antibody, Loading control

Applications WB
Reactivities Human, Mouse, Monkey, Dog, Rat
Conjugation Unconjugated
Immunogen ACTB Synthetic peptide conjugated to KLH derived from within residues 30-100 of Human ACTB

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

Rabbit Polyclonal beta-Actin Antibody

Applications Block/Neutralize, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Avian, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of human Beta Actin. [UniProt P60709].

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK

Rabbit Polyclonal Anti-ITGB7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGB7

Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707)

Anti-ITGB6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 139-434 amino acids of human integrin, beta 6

Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))

Applications IHC, WB
Reactivities Human (Predicted: Dog, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514)

Rabbit Polyclonal beta-Actin Antibody

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Amino acids 2-16 (CDDDIAALVIDNGSG) of actin protein were used as the immunogen.

Rabbit Polyclonal Anti-ITGA11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ITGA11

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1

N-cadherin Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human N-cadherin

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS

Rabbit Polyclonal Anti-ACTB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ACTB
TA349205 is a possible alternative to TA349208.