Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit polyclonal antibody to Collagen I alpha2 (collagen, type I, alpha 2)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1057 and 1366 of Collagen I alpha2 (Uniprot ID#P08123) |
Rabbit Polyclonal Anti-COL1A1 Antibody, Purified
| Applications | ELISA, IF, IHC, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Purified Collagen type I from Human skin. |
BP8028S is a replacement of BP8028.
Rabbit Polyclonal Anti-COL1A2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A2 antibody: synthetic peptide directed towards the middle region of human COL1A2. Synthetic peptide located within the following region: PGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPG |
Rabbit polyclonal Collagen I a2 (Cleaved-Gly1102) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen I a2. |
Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Porcine Collagen, types 1 and 3 from skin |
Rabbit Polyclonal Collagen I Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Collagen I |
Rabbit anti Collagen I Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein encoding aa 1160-1367 of human collagen I expressed in E.Coli. |
Active filters
Category
- Antibodies
Target Symbol
- COLLAGEN I
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome