Rabbit Polyclonal Anti-NEU1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG |
Rabbit Polyclonal Niemann-Pick C1 Antibody
| Applications | Electron Microscopy, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the C-terminal region of human Niemann-Pick C. [UniProt# O15118] |
Anti-ABCB9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 710-723 amino acids of human ATP-binding cassette, sub-family B (MDR/TAP), member 9 |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal LIMPII/lpg85 Antibody
| Applications | ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Canine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114] |
Rabbit Polyclonal NPC1 Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NPC1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human NPC1. |
Germany
Japan
United Kingdom
China
