Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Dog, Rat, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Anti-SOD2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOD2 antibody: synthetic peptide directed towards the N terminal of human SOD2. Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH |
Rabbit Polyclonal antibody to POLR2B (polymerase (RNA) II (DNA directed) polypeptide B, 140kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 172 of RNA polymerase IIB (Uniprot ID#P30876) |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit polyclonal CREB1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This CREB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 105-132 amino acids from the Central region of human CREB1. |
Germany
Japan
United Kingdom
China
