Rabbit Polyclonal CTTNBL1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1. |
Rabbit Polyclonal CTTNBL1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTTNBL1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CTTNBL1. |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Rat, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-CTNNBL1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTNNBL1 |
Rabbit Polyclonal Anti-DDX39B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DDX39B |
Rabbit Polyclonal Anti-HNRNPM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HNRNPM |
Rabbit polyclonal Hsp70 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Dog, Guinea Pig, Monkey, Pig, Sheep, Beluga, Cow, Hamster, Coral, Tomato, Tobacco, Dogfish, Hagfish, Carp |
Conjugation | Unconjugated |
Immunogen | Full length human protein Hsp70 |
Rabbit Polyclonal Anti-HSPA8 Antibody
Applications | IHC, WB |
Reactivities | Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE |
Rabbit Polyclonal Anti-CDC5L Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CDC5L |
Rabbit polyclonal hnRNP C1/C2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human hnRNP C1/C2. |
Rabbit Polyclonal Anti-RBMX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RBMX |
Rabbit polyclonal antibody to SAP130 (splicing factor 3b, subunit 3, 130kDa)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1154 and 1217 of SAP130 (Uniprot ID#Q15393) |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Zebrafish, Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal anti-hnRNP A1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from inetrnal of human hnRNP A1. |
Rabbit anti-HNRNPK Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HNRNPK |
hnRNP G (RBMX) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 20-60 of Human hnRNP G. |