Rabbit Polyclonal Anti-PIP5K1A Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pip5k1a antibody is: synthetic peptide directed towards the N-terminal region of Mouse Pip5k1a. Synthetic peptide located within the following region: EGPSASVMPVKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLS |
Rabbit Polyclonal Anti-PGK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGK1 antibody: synthetic peptide directed towards the N terminal of human PGK1. Synthetic peptide located within the following region: PEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFR |
Anti-NME6 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
ATP6AP1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Canine, Equine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human ATP6AP1 |
Rabbit Polyclonal Anti-COX6C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Feline, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide sequence from the C-terminus of GAD |
Germany
Japan
United Kingdom
China
