Rabbit Polyclonal BubR1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BubR1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Rabbit polyclonal CDK4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit polyclonal TTK (Ab-676) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit Polyclonal Bub1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bub1 antibody was raised against a 19 amino acid peptide from near the amino terminus of human Bub1. |
Rabbit polyclonal anti-DNA-PK antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human DNA-PK. |
Anti-GSK3B (Phospho-Tyr216) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 216 (V-S-Y(p)-I-C) derived from Human GSK3β. |
Modifications | Phospho-specific |
Rabbit polyclonal Plk1 phospho T210 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Polo-like Kinase pT210 Antibody was produced by repeated immunizations with a synthetic phospho peptide corresponding to aa 205-214 of Human Polo-like kinase 1 (Plk1) protein. |
PLK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PLK1 |
Rabbit Polyclonal Anti-PKMYT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PKMYT1 |
Rabbit Polyclonal ATM Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ATM antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human ATM. |
Rabbit polyclonal Phospho-CDK7(T170) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
Modifications | Phospho-specific |
Anti-CDK6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6 |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Rabbit Polyclonal Anti-CDK7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |