Anti-F2R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Anti-F2R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Anti-BDKRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2 |
Rabbit Polyclonal Anti-C3AR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human C3AR1 |
Rabbit polyclonal anti-BDKRB1 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BDKRB1. |
Modifications | Phospho-specific |
Anti-BDKRB2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2 |
Rabbit polyclonal Thrombin Receptor antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor. |
Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PAR1. |
Rabbit Polyclonal Anti-BDKRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDKRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human BDKRB1. Synthetic peptide located within the following region: RTREEVSRTRCGGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQ |
Rabbit Polyclonal Anti-F2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R. |
Rabbit Polyclonal Anti-F2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA |
Rabbit Polyclonal Anti-C5AR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C5AR1 antibody: synthetic peptide directed towards the C terminal of human C5AR1. Synthetic peptide located within the following region: SHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKTLK |
Rabbit Polyclonal Anti-BDKRB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |