Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Rabbit Polyclonal Anti-WWP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the middle region of human WWP2. Synthetic peptide located within the following region: SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP |
Rabbit polyclonal CUL4B Antibody (Center)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This CUL4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-278 amino acids from the Central region of human CUL4B. |
Rabbit Polyclonal Anti-DET1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DET1 antibody is: synthetic peptide directed towards the N-terminal region of Human DET1. Synthetic peptide located within the following region: DCRCVIVGSAAYLPDEPHPPFFEVYRNSESVTPNPRSPLEDYSLHIIDLH |
Rabbit Polyclonal Anti-MAP3K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Rabbit Polyclonal Anti-Phospho-BRCA1(Ser1457) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-BRCA1(Ser1457) Antibody: A synthesized peptide derived from human BRCA1 around the phosphorylation site of Sersine 1457 |
| Modifications | Phospho-specific |
Rabbit anti-CUL3 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CUL3 |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Pathways
- Ubiquitin mediated proteolysis
Citations
- Yes