Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ZMYM2 (1250-1300) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Human, Monkey, Mouse, Rat, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the amino acids 1250-1300 of human Zinc finger protein 198 |
USD 665.00
2 Weeks
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
TAOK1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Rat, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | TAOK1 antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human TAOK1. |
ALB rabbit polyclonal antibody, FITC
| Applications | ELISA, ID, IF, IHC, IP, R |
| Reactivities | Canine |
| Conjugation | FITC |
| Immunogen | Albumin is isolated from Canine (Dog) serum by sequential precipitation and purified by ion exchange chromatography and affinity chromatography. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
TIMP3 (175-211) rabbit polyclonal antibody, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Bovine, Canine, Equine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 175-211 of Human TIMP3 |
TIMP3 (175-211) rabbit polyclonal antibody, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Bovine, Canine, Equine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acids 175-211 of Human TIMP3 |
SAE1 rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bovine, Canine, Chimpanzee, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein produced by baculoviral expression in insect cells (Sf9, Spodoptera frugiperda) corresponding to full length Human SUMO Activating Enzyme E1 fused with GST |
CRM1 (XPO1) (390-408) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Human, Chimpanzee, Mouse, Rat, Bat, Chicken, Equine, Monkey, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the amino acids 390-408 of human Exportin-1 protein |
Eph receptor A2 (EPHA2) (450-500) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Equine, Human, Monkey, Mouse, Rat, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a portion of the amino acids 450-500 of Human EphA2 |
HOX11 (TLX1) (306-318) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Bat, Canine, Chicken, Equine, Hamster, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence corresponding to acids amino acids 306-318 of human HOX11 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Canine
Applications
- IHC
Antibody Hosts
- Rabbit
Isotypes
- IgG