Antibodies

View as table Download

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal anti-COX IV antibody, Loading control

Applications ChIP, ICC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Bovine, Primate, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073]

Rabbit Polyclonal HDAC2 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control

Applications IHC, WB
Reactivities Human, Mouse, Monkey, Dog
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796)

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal Anti-SDHB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SDHB

Rabbit Polyclonal Anti-NDUFA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NDUFA4

Rabbit Polyclonal antibody to NDUFS8 (NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase))

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 210 of NDUFS8 (Uniprot ID#O00217)

Rabbit polyclonal anti-HDAC-1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1.

Rabbit Polyclonal Anti-CLTC Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLTC

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Rabbit Polyclonal HAP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen HAP1 antibody was raised against a 19 amino acid peptide from near the center of human HAP1.