Rabbit polyclonal antibody to MCD (malonyl-CoA decarboxylase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 90 and 304 of (Uniprot ID#O95822) |
Rabbit polyclonal antibody to MCD (malonyl-CoA decarboxylase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 90 and 304 of (Uniprot ID#O95822) |
Rabbit polyclonal antibody to AKR1B10 (aldo-keto reductase family 1, member B10 (aldose reductase))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 316 of AKR1B10 (Uniprot ID#O60218) |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit polyclonal Cytochrome P450 19A1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 19A1. |
Rabbit Polyclonal DPAGT1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DPAGT1 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human DPAGT1. |
Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424) |
Rabbit Polyclonal antibody to SUCLG1 (succinate-CoA ligase, alpha subunit)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 346 of SUCLG1 (Uniprot ID#P53597) |
Rabbit Anti-NSE (Neuron specific enolase) Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant human NSE expressed in and purified from E. coli |
Rabbit polyclonal BCKDHB Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This BCKDHB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 41-70 amino acids from the N-terminal region of human BCKDHB. |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit polyclonal CD38 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Monkey) |
Conjugation | Unconjugated |
Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Rabbit Polyclonal Anti-ACADVL Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACADVL antibody: synthetic peptide directed towards the N terminal of human ACADVL. Synthetic peptide located within the following region: RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV |
Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)
Applications | IF, IHC, IP, WB |
Reactivities | Human (Predicted: Mouse, Rabbit, Rat, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520) |
Rabbit Polyclonal antibody to Arginase I (arginase, liver)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 322 of Arginase I (Uniprot ID#P05089) |
Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174) |