Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
Rabbit Polyclonal Calnexin Antibody
| Applications | FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
Rabbit Polyclonal LRRK2 Antibody
| Applications | FC, ICC/IF, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal synthetic peptide made to the human LRRK2 protein sequence (between residues 2500-2527). |
Rabbit Polyclonal Calreticulin Antibody
| Applications | Block/Neutralize, Dot, Electron Microscopy, FC, ICC/IF, IHC, IP, Protein Array, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein to mouse Calreticulin [UniProt# P14211] |
Rabbit Polyclonal PKM2 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618] |
Rabbit Polyclonal Perilipin Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal SR-BI Antibody
| Applications | Block/Neutralize, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Hamster, Mustelid |
| Conjugation | Unconjugated |
| Immunogen | A C-terminal peptide containing residues from mouse SR-BI (within residues 450-509). [UniProt# Q61009] |
Rabbit polyclonal ENOA Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Dog, Feline, Pig, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal ASPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This ASPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-110 amino acids from the N-terminal region of human ASPA. |
Rabbit polyclonal GC Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Pig) |
| Conjugation | Unconjugated |
| Immunogen | This GC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 337-365 amino acids from the Central region of human GC. |
Rabbit polyclonal EXT2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken, Monkey, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit Polyclonal CXCR7/RDC-1 Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding amino acids 106-129 of human CXCR7/RDC1 was used as the immunogen, GenBank NP_064707.1. |
Germany
Japan
United Kingdom
China
