Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Bovine, Human, Monkey, Porcine, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK. |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Goat Polyclonal Antibody against CTSK
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTHRKQYNNKVDE, from the internal region (near N-terminus) of the protein sequence according to NP_000387.1. |
Rabbit Polyclonal Anti-CTSK Antibody
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY |
Active filters
Target Symbol
- CATHEPSIN K
Reactivities
- Human
Pathways
- Lysosome