Primary Antibodies

View as table Download

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Collagen I (COL1A1) rabbit polyclonal antibody, Biotin

Applications ELISA, FC, IHC, IP, WB
Reactivities Bovine, Human, Mammalian, Mouse, Rat
Conjugation Biotin
Immunogen Collagen Type I from Human and Bovine placenta.

Collagen I mouse monoclonal antibody, clone 3G3, Purified from ascites by Protein A

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH

Rabbit polyclonal Collagen I a2 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen I a2.

Anti-COL1A2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1133-1366 amino acids of human collagen, type I, alpha 2

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human COL1A2.

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS

Rabbit Polyclonal Collagen I alpha 1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Collagen I protein (between residues 150-200) [UniProt P02452]

Rabbit Polyclonal Collagen I alpha 1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal portion of the human Collagen I protein (between residues 1300-1350) [UniProt P02452]

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal antibody to Collagen I alpha2 (collagen, type I, alpha 2)

Applications IF, WB
Reactivities Human (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1057 and 1366 of Collagen I alpha2 (Uniprot ID#P08123)

Rabbit Polyclonal Anti-COL1A1 Antibody, Purified

Applications ELISA, IF, IHC, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Purified Collagen type I from Human skin.
BP8028S is a replacement of BP8028.

Rabbit Polyclonal Anti-COL1A2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A2 antibody: synthetic peptide directed towards the middle region of human COL1A2. Synthetic peptide located within the following region: PGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPG

Collagen I (COL1A1) mouse monoclonal antibody, clone NFI/20, Purified

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated