Rabbit Polyclonal TCIRG1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal TCIRG1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal antibody to UQCRFS1 (ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1)
Applications | IF, WB |
Reactivities | Human, Mouse (Predicted: Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 274 of UQCRFS1 (Uniprot ID#P47985) |
Rabbit Polyclonal antibody to NDUFS2 (NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 430 of NDUFS2 (Uniprot ID#O75306) |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 43 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Expected from sequence similarity: Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 115 and 355 of NDUFA10 (Uniprot ID#O95299) |
Anti-COX7B2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-COX8A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Chicken, Drosophila, C. elegans) |
Conjugation | Unconjugated |
Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal Anti-NDUFAB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NDUFAB1 |
Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Chimpanzee) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404) |
Anti-COX6B2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-89 amino acids of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) |
Anti-COX6B1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |