Primary Antibodies

View as table Download

P-tau217 Rabbit monoclonal antibody,clone OTIR1A9

Applications ELISA
Reactivities Human
Conjugation Unconjugated

P-tau217 Rabbit monoclonal antibody,clone OTIR1A10

Applications ELISA
Reactivities Human
Conjugation Unconjugated

P-tau217 Rabbit monoclonal antibody,clone OTIR3B5

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Ac-tau281 Rabbit monoclonal antibody,clone OTIR5E7

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Ac-tau281 Rabbit monoclonal antibody,clone OTIR5D9

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Ac-tau281 Rabbit monoclonal antibody,clone OTIR5B10

Applications ELISA
Reactivities Human
Conjugation Unconjugated

P-tau181 Rabbit monoclonal antibody,clone OTIR1C12

Applications ELISA
Reactivities Human
Conjugation Unconjugated

P-tau181 Rabbit monoclonal antibody,clone OTIR5A6

Applications ELISA
Reactivities Human
Conjugation Unconjugated

P-tau181 Rabbit monoclonal antibody,clone OTIR2F8

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

Rabbit Polyclonal Anti-UQCRQ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK

Rabbit Polyclonal Anti-SDHB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SDHB

Rabbit polyclonal GAPDH Antibody (C-term R248)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Chicken, Pig)
Conjugation Unconjugated
Immunogen This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH.

Rabbit Polyclonal Anti-NDUFA4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NDUFA4

Rabbit Polyclonal CD10 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.