P-tau217 Rabbit monoclonal antibody,clone OTIR1A9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
P-tau217 Rabbit monoclonal antibody,clone OTIR1A9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
P-tau217 Rabbit monoclonal antibody,clone OTIR1A10
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
P-tau217 Rabbit monoclonal antibody,clone OTIR3B5
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Ac-tau281 Rabbit monoclonal antibody,clone OTIR5E7
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Ac-tau281 Rabbit monoclonal antibody,clone OTIR5D9
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Ac-tau281 Rabbit monoclonal antibody,clone OTIR5B10
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
P-tau181 Rabbit monoclonal antibody,clone OTIR1C12
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
P-tau181 Rabbit monoclonal antibody,clone OTIR5A6
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
P-tau181 Rabbit monoclonal antibody,clone OTIR2F8
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit Polyclonal Anti-UQCRQ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UQCRQ antibody is: synthetic peptide directed towards the middle region of Human UQCRQ. Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SDHB |
Rabbit polyclonal GAPDH Antibody (C-term R248)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Chicken, Pig) |
Conjugation | Unconjugated |
Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH. |
Rabbit Polyclonal Anti-NDUFA4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NDUFA4 |
Rabbit Polyclonal CD10 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |