Primary Antibodies

View as table Download

ALAD (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human ALAD

Rabbit Polyclonal Anti-ALAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP

Rabbit Polyclonal Anti-ALAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT

Rabbit Polyclonal Anti-ALAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAD antibody: synthetic peptide directed towards the middle region of human ALAD. Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD

Rabbit Polyclonal Anti-ALAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT

ALAD Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ALAD