Primary Antibodies

View as table Download

MSH2 mouse monoclonal antibody,clone UMAB259

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody,clone UMAB259

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody, clone OTI10F7

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSH2 mouse monoclonal antibody, clone OTI10F7, Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin

MSH2 mouse monoclonal antibody, clone OTI10F7, HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP

MSH2 mouse monoclonal antibody,clone UMAB259

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit polyclonal MSH2 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 637-665 amino acids from the Central region of human MSH2.

Rabbit polyclonal anti-MSH2 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MSH2.

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG

Mouse monoclonal anti-MSH2 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MSH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV