Primary Antibodies

View as table Download

Rabbit polyclonal HNF1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

Anti-GCK Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4)

Anti-HNF1B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 36-50 amino acids of human HNF1 homeobox B

Rabbit Polyclonal Anti-IAPP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IAPP

Anti-IAPP Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 40-52 amino acids of Human Islet amyloid polypeptide

Rabbit polyclonal HNF1B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 50-150 of Human HNF1B.

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Goat Polyclonal Antibody against FOXA2

Applications IHC, WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1.

Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823)

Rabbit Polyclonal NKX2-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NKX2-2 antibody was raised against a 19 amino acid synthetic peptide near the center of human NKX2-2.

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Rabbit Polyclonal Anti-PAX4 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA