Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 25 results

Page 1 of 2

(reset)

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

TA505544

USD 478.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	IHC, WB
Reactivities	Human, Dog, Monkey
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

CF505544

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	IHC, WB
Reactivities	Human, Dog, Monkey
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

TA505568

USD 447.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI5H2]

TA505597

USD 447.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI10B2]

TA505625

USD 447.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)

Applications	IF, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI5H2]

CF505597

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI5H2 (formerly 5H2)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1C9]

TA505544S

USD 200.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	IHC, WB
Reactivities	Human, Dog, Monkey
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

CF505568

USD 600.00

3 Weeks

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1E10]

TA505442

USD 447.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI1E10]

CF505442

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI10B2]

CF505625

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GLB1 mouse monoclonal antibody, clone OTI10B2 (formerly 10B2)

Applications	IF, WB
Reactivities	Human, Dog, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

GLB1 Mouse Monoclonal Antibody [Clone ID: OTI2F6]

TA505568S

USD 200.00

In Stock

GLB1 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

GLB1 Rabbit Polyclonal Antibody

TA308238

USD 625.00

In Stock

Rabbit polyclonal antibody to beta-Gal (galactosidase, beta 1)

Applications	IHC, WB
Reactivities	Human (Predicted: Dog, Feline)
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 166 and 677 of beta-Gal (Uniprot ID#P16278)

1 / 2

2 / 2

Previous Next

HEXB Rabbit Polyclonal Antibody

TA314004

USD 380.00

2 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

1 / 2

2 / 2

Previous Next

HEXA Rabbit Polyclonal Antibody

TA343107

USD 539.00

5 Days

Rabbit Polyclonal Anti-HEXA Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV

1 / 2

2 / 2

Previous Next

1 - 15 of 25 results

Page 1 of 2