Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit polyclonal anti-ATP6V1H antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit Polyclonal Anti-UQCRC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
Rabbit Polyclonal Anti-COX6C Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
Germany
Japan
United Kingdom
China
