AQP1 (Aquaporin 1) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
AQP1 (Aquaporin 1) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-KCTD5 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Goat Polyclonal Antibody against ABCC4
Applications | IHC, WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2. |
ABCC4 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
AQP1 (Aquaporin 1) mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Anti-CX43 Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 230 aa to the C-terminus of rat CX43 produced in E. coli. |
NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey, Dog |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796) |
Anti-CHRFAM7A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 32-46 amino acids of human CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion |
NUDT9 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-KCNAB2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Goat Polyclonal Antibody against VDAC2 (C Terminus)
Applications | IHC, PEP-ELISA, WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GHKVGLALELEA, from the C Terminus of the protein sequence according to NP_003366.2. |
Aquaporin 1 (AQP1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the C-terminal of human AQP1 |
NUDT9 mouse monoclonal antibody, clone OTI 7F12 (formerly 7F12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".