Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 24 results

Page 1 of 2

(reset)

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: UMAB15]

UM500015

USD 564.00

In Stock

Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15

Applications	10k-ChIP, FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated

• 

1 / 23

2 / 23

3 / 23

4 / 23

5 / 23

6 / 23

7 / 23

8 / 23

9 / 23

10 / 23

11 / 23

12 / 23

13 / 23

14 / 23

15 / 23

16 / 23

17 / 23

18 / 23

19 / 23

20 / 23

21 / 23

22 / 23

23 / 23

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

TA502409

USD 447.00

In Stock

CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

TA502409S

USD 200.00

In Stock

CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

JNK1 (MAPK8) Mouse Monoclonal Antibody [Clone ID: OTI1C2]

TA500043

USD 447.00

In Stock

JNK1 (MAPK8) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody

AP51124PU-N

USD 580.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

1 / 3

2 / 3

3 / 3

Previous Next

DKK1 Goat Polyclonal Antibody

TA302464

USD 520.00

In Stock

Goat Polyclonal Antibody against DKK1

Applications	FC, IF, IHC, PEP-ELISA, WB
Reactivities	Human (Expected from sequence similarity: Rat, Dog, Pig, Cow)
Conjugation	Unconjugated
Immunogen	Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

beta Catenin (CTNNB1) Goat Polyclonal Antibody

AB0095-200

USD 355.00

In Stock

Goat Polyclonal Anti-beta-Catenin Antibody

Applications	IF, WB
Reactivities	Canine, Human, Monkey, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Purified recombinant peptide derived from within residues 731 aa to the C-terminus of human beta Catenin produced in E. coli.

1 / 2

2 / 2

Previous Next

SMAD3 Rabbit Polyclonal Antibody

TA325852

USD 380.00

4 Weeks

Rabbit Polyclonal Smad2/3 (Thr8) Antibody (Phospho-specific)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human Smad2/3 around the phosphorylation site of Threonine 8
Modifications	Phospho-specific

WNT2 Rabbit Polyclonal Antibody

TA351948

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-WNT2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human WNT2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

JNK1 (MAPK8) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

TA500275

USD 447.00

In Stock

Anti-JNK1 (JNK1) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

WNT5A Rabbit Polyclonal Antibody

TA329908

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WNT5A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

JNK1 (MAPK8) Rabbit Polyclonal Antibody

TA325663

USD 380.00

4 Weeks

Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185
Modifications	Phospho-specific

JNK1 (MAPK8) Mouse Monoclonal Antibody [Clone ID: OTI1C2]

TA500043S

USD 200.00

2 Days

JNK1 (MAPK8) mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PKC alpha (PRKCA) (pan) Rabbit Polyclonal Antibody

AP06566PU-N

USD 465.00

3 Weeks

PKC alpha (PRKCA) (pan) rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 470-520 of Human PKC-pan.

1 / 2

2 / 2

Previous Next

WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]

AM09053PU-N

USD 430.00

3 Weeks

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

1 - 15 of 24 results

Page 1 of 2