Primary Antibodies

Jump to Filters
View as table Download
BRCA1 Rabbit Polyclonal Antibody
TA310042

USD 565.00

In Stock

Rabbit anti-BRCA1 polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from humanBRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P).
SOCS1 Rabbit Polyclonal Antibody
TA321593

USD 380.00

In Stock

Anti-SOCS1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-211 amino acids of Human suppressor of cytokine signaling 1
Mps1 (TTK) Rabbit Polyclonal Antibody
TA314651

USD 380.00

4 Weeks

Rabbit polyclonal TTK (Ab-676) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V).
MDM2 Rabbit Polyclonal Antibody
TA311996

USD 380.00

In Stock

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).
Apc10 (ANAPC10) Rabbit Polyclonal Antibody
TA319413

USD 765.00

5 Days

Rabbit polyclonal anti-APC10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10.
Ube1L (UBA7) Rabbit Polyclonal Antibody
TA313018

USD 380.00

4 Weeks

Rabbit polyclonal anti-UBE1L / UBA7 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human UBE1L.
TRAF6 Rabbit Polyclonal Antibody
TA306124

USD 570.00

5 Days

Rabbit Polyclonal TRAF6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TRAF6 antibody was raised against a peptide corresponding to 14 amino acids near the C-terminus of human TRAF6.
cIAP2 (BIRC3) Rabbit Polyclonal Antibody
TA590350

USD 482.00

In Stock

Rabbit Polyclonal cIAP2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
WWP2 Rabbit Polyclonal Antibody
TA329807

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-WWP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the middle region of human WWP2. Synthetic peptide located within the following region: SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA346746

USD 539.00

5 Days

Rabbit Polyclonal Anti-MAP3K1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
BRCA1 Rabbit Polyclonal Antibody
TA348436

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Phospho-BRCA1(Ser1457) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-BRCA1(Ser1457) Antibody: A synthesized peptide derived from human BRCA1 around the phosphorylation site of Sersine 1457
Modifications Phospho-specific
Cullin 3 (CUL3) Rabbit Polyclonal Antibody
TA326917

USD 365.00

3 Weeks

Rabbit anti-CUL3 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL3