Primary Antibodies

Jump to Filters
View as table Download
NEU4 (C-term) Rabbit Polyclonal Antibody
AP52856PU-N

USD 580.00

2 Weeks

NEU4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 430-461 amino acids from the C-terminal region of Human Sialidase-4
NEU4 Rabbit Polyclonal Antibody
TA340248

USD 539.00

5 Days

Rabbit Polyclonal Anti-NEU4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU4 antibody: synthetic peptide directed towards the N terminal of human NEU4. Synthetic peptide located within the following region: TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE