Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Human, Fish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Monkey, Dog, Xenopus, Rat, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Mouse Monoclonal anti-HSPA1A Antibody
| Applications | FC |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Tubulin β (4D9) monoclonal antibody-HRP
| Applications | WB |
| Reactivities | Human, Mouse, Rabbit, Frog, Fish, Chicken, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 402-455 of Human Tubulin β. |
Acetylcholinesterase rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Fish, Human |
| Conjugation | Unconjugated |
| Immunogen | Highly purified Acetylcholine Esterase from Electrophorus electricus. |
Anti-Connexin 35/36 (Ser276) Antibody
| Applications | IHC, WB |
| Reactivities | Fish, Mouse, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues of perch connexin 35/36 surrounding Ser276, conjugated to keyhole limpet hemocyanin (KLH). |
VIP rabbit polyclonal antibody, Serum
| Applications | IHC |
| Reactivities | Feline, Fish, Human, Mammalian, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified porcine VIP. |
Germany
Japan
United Kingdom
China
