Anti-NPY1R rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1 |
Anti-NPY1R rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1 |
Rabbit Polyclonal S1P1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1. |
Anti-MTNR1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 130-144 amino acids of human melatonin receptor 1A |
Goat Polyclonal Antibody against HCRTR1
Applications | IF, WB |
Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YNFLSGKFREQFK, from the internal region of the protein sequence according to NP_001516.1; NP_001517.1. |
Anti-GLP2R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-179 amino acids of human glucagon-like peptide 2 receptor |
Anti-ADRB2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 21-33 amino acids of Human adrenoceptor beta 2, surface |
Rabbit polyclonal anti-FZD9 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9. |
Anti-HCRTR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 393-405 amino acids of Human hypocretin (orexin) receptor 1 |
Anti-MC1R Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 301-315 amino acids of human melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) |
Anti-SSTR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1 |
Rabbit Polyclonal AGTR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1. |
Anti-DRD4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human Dopamine receptor D4 |
Anti-GRPR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 350-365 amino acids of Human gastrin-releasing peptide receptor |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Goat Polyclonal Antibody against CCKBR
Applications | IHC, WB |
Reactivities | Human, Rat (Expected from sequence similarity: Mouse, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-FDGDSDSDSQSRVRNQ, from the internal region of the protein sequence according to NP_795344.1. |