Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against Eg5
| Applications | ICC/IF, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
USD 410.00
2 Weeks
Complement C5 (C5) (neoepitope) mouse monoclonal antibody, clone HCC5b.1 (neo), Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Goat, Human, Porcine, Primate |
| Conjugation | Unconjugated |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Thrombospondin 1 (THBS1) (19-32) goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Canine, Equine, Goat, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Bovine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from N-Terminus of human THBS1 (NP_003237.2) |
Rabbit Polyclonal Anti-PAK6 Antibody (Linker Domain)
| Applications | IHC |
| Reactivities | Human (Predicted: Goat, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | PAK6 antibody was raised against synthetic 18 amino acid peptide from Linker domain of human PAK6. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Dog, Horse (100%); Goat, Elephant, Panda, Rabbit (94%); Hamster, Bovine (89%); Mouse, Bat (83%). |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Dog, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Gibbon, Hamster, Horse (Predicted: Mouse, Rat, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
Active filters
Filter by
Target Symbol
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Assay Types
Pathways
- Neuroactive ligand-receptor interaction (3)
- Alzheimer's disease (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Focal adhesion (2)
- GnRH signaling pathway (2)
- Adipocytokine signaling pathway (1)
- Apoptosis (1)
- Arginine and proline metabolism (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Complement and coagulation cascades (1)
- Cytokine-cytokine receptor interaction (1)
- ECM-receptor interaction (1)
- ErbB signaling pathway (1)
- Gap junction (1)
- Long-term depression (1)
- MAPK signaling pathway (1)
- Metabolic pathways (1)
- Pathogenic Escherichia coli infection (1)
- Pathways in cancer (1)
- Prion diseases (1)
- Regulation of actin cytoskeleton (1)
- Renal cell carcinoma (1)
- Small cell lung cancer (1)
- Systemic lupus erythematosus (1)
- T cell receptor signaling pathway (1)
- TGF-beta signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- Vascular smooth muscle contraction (1)
- p53 signaling pathway (1)