Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal ATM Antibody
| Applications | ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
Rabbit Polyclonal CDKN2A Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A. |
Rabbit Polyclonal Serpin E1/PAI-1 Antibody
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 300-400) [UniProt P05121] |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
