Primary Antibodies

View as table Download

Rabbit polyclonal antibody to SHC4 (SHC (Src homology 2 domain containing) family, member 4)

Applications WB
Reactivities Human (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 352 and 630 of SHC4 (Uniprot ID#Q6S5L8)

Rabbit Polyclonal Anti-SHC4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP