Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Rabbit polyclonal anti-AKT antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Chicken
Conjugation Unconjugated
Immunogen AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Rabbit Polyclonal Anti-HIF1A Antibody

Applications WB
Reactivities Human, Chicken, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA

Rabbit polyclonal antibody to RSK1 p90 (ribosomal protein S6 kinase, 90kDa, polypeptide 1)

Applications IF, WB
Reactivities Human (Predicted: Mouse, Chicken, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 303 and 527 of RSK1

Rabbit Polyclonal Antibody against VEGFA

Applications ELISA, WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Chicken
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins.

Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Chicken, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins

Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat, Chicken, Canis
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins.

Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody

Applications WB
Reactivities Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin

Rabbit anti AMPK-alpha Polyclonal Antibody

Applications WB
Reactivities Human, Rat, Mouse, Bovine, Chicken, Dog, Invertebrate
Conjugation Unconjugated
Immunogen A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin