Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 56 results

Page 1 of 4

(reset)

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

TA503310

USD 447.00

In Stock

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Monkey, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1D10]

CF503310

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Monkey, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1A2]

TA503038

USD 447.00

In Stock

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications	FC, IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody

TA334652

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

1 / 3

2 / 3

3 / 3

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI2G3]

TA503188

USD 447.00

In Stock

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1A2]

CF503038

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)

Applications	FC, IF, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI2G3]

CF503188

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D10]

TA503310AM

USD 509.00

2 Weeks

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Monkey, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D10]

TA503310BM

USD 509.00

2 Weeks

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1D10 (formerly 1D10), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Dog, Monkey, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Monoclonal Antibody [Clone ID: OTIR4H3]

TA592779

USD 471.00

In Stock

G6PC Rabbit monoclonal antibody,clone OTIR4H3

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Monoclonal Antibody [Clone ID: OTIR5G10]

TA592780

USD 471.00

In Stock

G6PC Rabbit monoclonal antibody,clone OTIR5G10

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Monoclonal Antibody [Clone ID: OTIR2H10]

TA592781

USD 471.00

In Stock

G6PC Rabbit monoclonal antibody,clone OTIR2H10

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1C5]

TA503309

USD 447.00

In Stock

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

TA503037

USD 447.00

In Stock

PTPN1 (PTP1B) mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PTP1B (PTPN1) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

CF503037

USD 600.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTPN1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)

Applications	FC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

1 - 15 of 56 results

Page 1 of 4