Germany
Japan
United Kingdom
China
USD 509.00
2 Weeks
BST1 mouse monoclonal antibody,clone OTI9B2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
BST1 mouse monoclonal antibody,clone OTI9B2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 509.00
2 Weeks
BST1 mouse monoclonal antibody,clone OTI4E4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 509.00
2 Weeks
BST1 mouse monoclonal antibody,clone OTI4E4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
CD73 (NT5E) (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NT5E antibody was raised against kLH conjugated synthetic peptide between 520-550 amino acids from the C-terminal region of human CD73 (NT5E). |
Rabbit polyclonal anti-BST1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BST1. |
Rabbit Polyclonal Anti-NNT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM |
ENPP1 mouse monoclonal antibody,clone OTI8C7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Mouse monoclonal CD73(NT5E) Antibody (C-term)(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal anti-NT5E antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Goat Anti-CD38 (aa226-237) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EVHNLQPEKVQT, from the internal region of the protein sequence according to NP_001766.2. |
Rabbit Polyclonal Anti-NT5C3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Active filters
Applications
- WB
Families
- Transmembrane
Pathways
- Nicotinate and nicotinamide metabolism