NNT Rabbit Polyclonal Antibody

CAT#: TA341910

Rabbit Polyclonal Anti-NNT Antibody

Product Images

WB Suggested Anti-NNT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Liver

• 

  Host: Rabbit; Target Name: NNT; Sample Tissue: Hela Whole cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/Lane; Gel Concentra

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NNT antibody: synthetic peptide directed towards the N terminal of human NNT. Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 114 kDa
• Gene Name: nicotinamide nucleotide transhydrogenase
• Database Link:
  NP_036475
  Entrez Gene 23530 Human
  UniProt ID Q13423
• Background: This gene encodes an integral protein ofThe inner mitochondrial membrane.The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation acrossThe inner mitochondrial membrane. Under most physiological conditions,The enzyme uses energy fromThe mitochondrial proton gradient to produce high concentrations of NADPH.The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encodingThe same protein, have been found forThis gene. [provided by RefSeq, Jul 2008]
• Synonyms: GCCD4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism