Germany
Japan
United Kingdom
China
Rat monoclonal anti-TUBA1A(alpha Tubulin ) antibody, clone YL1/2, Loading control
| Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mammalian, Mouse, Rat, Yeast |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
| Applications | ELISA, IF, IHC, IP, R, WB |
| Reactivities | Mammalian, Yeast, Birds |
| Conjugation | Unconjugated |
Mouse monoclonal Hsp60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Monkey, Pig, Rabbit, Helicobacter pylori, Hamster, Spinach, Salmonella Typhimurium, Trichinella spiralis, Yeast, Escherichia coli, White Fly |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
USD 585.00
2 Weeks
KDEL Receptor (KDELR1) (C-term) mouse monoclonal antibody, clone 2E7, Purified
| Applications | IF, WB |
| Reactivities | Drosophila, Plant, Yeast |
| Conjugation | Unconjugated |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
| Conjugation | Unconjugated |
| Immunogen | Recombinant human Caspase-3 protein (full length) |
Active filters
Reactivities
- Yeast
Applications
- WB
Families
- Druggable Genome
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Assay Types
Pathways
- Cell cycle (3)
- Colorectal cancer (3)
- Gap junction (3)
- MAPK signaling pathway (3)
- Pathogenic Escherichia coli infection (3)
- Pathways in cancer (3)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Bladder cancer (2)
- Chronic myeloid leukemia (2)
- Endometrial cancer (2)
- Huntington's disease (2)
- Small cell lung cancer (2)
- Thyroid cancer (2)
- Wnt signaling pathway (2)
- p53 signaling pathway (2)
- Acute myeloid leukemia (1)
- Alzheimer's disease (1)
- Basal cell carcinoma (1)
- Base excision repair (1)
- DNA replication (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Glioma (1)
- Jak-STAT signaling pathway (1)
- Melanoma (1)
- Mismatch repair (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Nucleotide excision repair (1)
- Pancreatic cancer (1)
- Parkinson's disease (1)
- Prostate cancer (1)
- RNA degradation (1)
- TGF-beta signaling pathway (1)
- Type I diabetes mellitus (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)