Goat Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Goat Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 240 aa to the C-terminus of human GAPDH produced in E. coli. |
Rabbit Polyclonal Antibody against ATG5
| Applications | Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Mouse, Pig, Rat, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
GFAP (K39) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | GFAP preparation from Human spinal cord. |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Rabbit Polyclonal Antibody against TARDBP
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Rabbit Polyclonal Antibody against MAT2 alpha
| Applications | ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
| Applications | FC, ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Genomic sequence made to an N-terminal portion of the human LC3A protein [Swiss-Prot# Q9H492]. |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Germany
Japan
United Kingdom
China
