Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal HDAC6 Antibody
| Applications | ChIP, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This antibody was generated by immunizing rabbits with a synthetic peptide corresponding to amino acids 1-16 of human HDAC6. |
Rabbit Polyclonal HDAC6 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human HDAC6 protein (between residues 1175-1215) [UniProt Q9UBN7] |
Rabbit Polyclonal anti-HDAC6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 antibody: synthetic peptide directed towards the N terminal of human HDAC6. Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ |
Rabbit Polyclonal HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal HDAC6 (Ser22) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC6 around the phosphorylation site of Serine 22 |
| Modifications | Phospho-specific |
Rabbit anti-HDAC6 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HDAC6 |
Goat Anti-HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AHQNKFGEDMPHPH, from the C Terminus of the protein sequence according to NP_006035.2. |
Rabbit Polyclonal Anti-HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 Antibody: A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 Antibody: A synthesized peptide derived from human HDAC6 |
Active filters
Target Symbol
- HDAC6
Applications
- WB
Clonalities
- Polyclonal
Families
- Druggable Genome