Primary Antibodies

Jump to Filters
View as table Download
Xanthine Oxidase (XDH) (N-term) Rabbit Polyclonal Antibody
AP54582PU-N

USD 580.00

2 Weeks

Xanthine Oxidase (XDH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 213~242 amino acids from the N-terminal region of human XDH
Xanthine Oxidase (XDH) Guinea Pig Polyclonal Antibody
AP09533SU-N

USD 490.00

2 Weeks

Xanthine Oxidase (XDH) guinea pig polyclonal antibody, Serum

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Xanthine Oxidase purified from Bovine Milk Fat Globule Membrane (MFGM).
Xanthine Oxidase (XDH) Rabbit Polyclonal Antibody
TA343291

USD 539.00

5 Days

Rabbit Polyclonal Anti-XDH Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Xdh antibody is: synthetic peptide directed towards the N-terminal region of Rat Xdh. Synthetic peptide located within the following region: EFFSAFKQASRREDDIAKVTSGMRVLFKPGTIEVQELSLCFGGMADRTIS