Rabbit Polyclonal Anti-MCM7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MCM7 antibody is: synthetic peptide directed towards the N-terminal region of Human MCM7. Synthetic peptide located within the following region: KYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAV |
Rabbit polyclonal Anti-Rfc1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG |
Rabbit polyclonal Anti-RFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC1 antibody: synthetic peptide directed towards the middle region of human RFC1. Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL |
Rabbit Polyclonal Anti-MCM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM5 Antibody: A synthesized peptide derived from human MCM5 |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
Rabbit anti-MCM2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM2 |
Germany
Japan
United Kingdom
China