RFC1 Rabbit Polyclonal Antibody

CAT#: TA342195

Rabbit polyclonal Anti-RFC1 Antibody

Product Images

WB Suggested Anti-RFC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFC1 antibody: synthetic peptide directed towards the middle region of human RFC1. Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 128 kDa
• Gene Name: replication factor C subunit 1
• Database Link:
  NP_002904
  Entrez Gene 5981 Human
  UniProt ID P35251
• Background: This gene encodesThe large subunit of replication factor C, a five subunit DNA polymerase accessory protein, which is a DNA-dependent ATPase required for eukaryotic DNA replication and repair.The large subunit acts as an activator of DNA polymerases, binds toThe 3' end of primers, and promotes coordinated synthesis of both strands. It may also have a role in telomere stability. Alternatively spliced transcript variants encoding different isoforms have been noted forThis gene. [provided by RefSeq, Mar 2011]
• Synonyms: A1; MHCBFB; PO-GA; RECC1; RFC; RFC140
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: DNA replication, Mismatch repair, Nucleotide excision repair