Primary Antibodies

View as table Download

TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)

Applications IHC, WB
Reactivities Human, Dog, Monkey
Conjugation Unconjugated

TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)

Applications IHC, WB
Reactivities Human, Dog, Monkey
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)

Applications IHC, WB
Reactivities Human, Dog, Monkey
Conjugation Unconjugated

Anti-TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5), Biotinylated

Applications IHC, WB
Reactivities Human, Dog, Monkey
Conjugation Biotin

TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5), HRP conjugated

Applications IHC, WB
Reactivities Human, Dog, Monkey
Conjugation HRP

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TRPM4 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI