Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal BLNK (Tyr84) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BLNK around the phosphorylation site of tyrosine 84 (E-M-YP-V-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to B-cell linker protein (B-cell linker)
| Applications | IF, WB |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 394 and 456 of BLNK (Uniprot ID#Q8WV28) |
Rabbit Polyclonal BLNK Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BLNK |
Rabbit Polyclonal BLNK (Tyr96) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BLNK around the phosphorylation site of Tyrosine 96 |
| Modifications | Phospho-specific |
BLNK (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This BLNK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human BLNK. |
Goat Polyclonal Antibody against BLNK
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KDSTRLKYAVKVS, from the C Terminus of the protein sequence according to NP_037446.1. |
Rabbit Polyclonal Anti-BLNK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLNK antibody: synthetic peptide directed towards the middle region of human BLNK. Synthetic peptide located within the following region: QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV |
Active filters
Category
- Antibodies
Target Symbol
- BLNK
Applications
- WB
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Primary immunodeficiency