Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
TRPM8 mouse monoclonal antibody,clone OTI7A11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
| Applications | IHC, WB |
| Reactivities | Human, Dog, Monkey |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against TRPM8 (Center R536)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8. |
Rabbit Polyclonal Anti-TRPM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |
Rabbit Polyclonal Anti-TRPA1 Antibody
| Applications | IHC, WB |
| Reactivities | Rat, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPA1 antibody: synthetic peptide directed towards the middle region of human TRPA1. Synthetic peptide located within the following region: KCTDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLAL |
Rabbit Polyclonal Anti-TRPM8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPM8 antibody: synthetic peptide directed towards the N terminal of human TRPM8. Synthetic peptide located within the following region: YILDNNHTHLLLVDNGCHGHPTVEAKLRNQLEKYISERTIQDSNYGGKIP |
Active filters
Category
- Antibodies
Applications
- WB
Families
- Ion Channels: Transient receptor potential
Citations
- Yes