Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Mouse Monoclonal eNOS Antibody (6H2)
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336799 is a replacement of AM06374SU-N.
Rabbit Polyclonal ASK1 Antibody
| Applications | ELISA, ICC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ASK1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human ASK1 This sequence is different from that of mouse by last two amino acids. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Applications
- WB
Assay Types
- Indirect
Pathways
- Amyotrophic lateral sclerosis (ALS)