Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 15 of 29 results

Page 1 of 2

(reset)

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA500072

USD 447.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

C1S Mouse Monoclonal Antibody [Clone ID: OTI2A8]

TA504247

USD 447.00

In Stock

C1S mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications	IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

CF500072

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

TA500072S

USD 200.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

alpha Actinin (ACTN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]

TA500072AM

USD 509.00

2 Weeks

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

alpha Actinin (ACTN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A4]

TA500072BM

USD 509.00

2 Weeks

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

C1S Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A8]

TA504247AM

USD 509.00

In Stock

C1S mouse monoclonal antibody,clone 2A8, Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

C1S Mouse Monoclonal Antibody [Clone ID: OTI2A8]

CF504247

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) C1S mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)

Applications	IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

C1S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A8]

TA504247BM

USD 509.00

In Stock

C1S mouse monoclonal antibody,clone 2A8, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat, Monkey, Mouse
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

H2A.Z (H2AFZ) Rabbit Polyclonal Antibody

TA308893

USD 625.00

5 Days

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications	IF, IHC, IP, WB
Reactivities	Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse)
Conjugation	Unconjugated
Immunogen	Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

alpha Actinin (ACTN1) Rabbit Polyclonal Antibody

TA321277

USD 380.00

In Stock

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

alpha Actinin 4 (ACTN4) Rabbit Polyclonal Antibody

TA349672

USD 380.00

In Stock

Rabbit Polyclonal Anti-ACTN4 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human ACTN4

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 605.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	FC, ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

alpha Actinin (ACTN1) Rabbit Polyclonal Antibody

TA344352

USD 539.00

5 Days

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 15 of 29 results

Page 1 of 2