USD 478.00
In Stock
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 478.00
In Stock
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody,clone UMAB165
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RRM1 mouse monoclonal antibody,clone UMAB165
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 447.00
In Stock
GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GSR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Zebrafish |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
USD 600.00
4 Weeks
Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RRM1 mouse monoclonal antibody,clone UMAB165
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 509.00
2 Weeks
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Dog, Rat, Mouse |
Conjugation | HRP |
USD 200.00
In Stock
ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".