Primary Antibodies

View as table Download

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody,clone UMAB165

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RRM1 mouse monoclonal antibody,clone UMAB165

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-GSR Antibody

Applications IF, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RRM1 mouse monoclonal antibody,clone UMAB165

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), Biotinylated

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation Biotin

GSS (Glutathione Synthetase) mouse monoclonal antibody, clone OTI2F2 (formerly 2F2), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Dog, Rat, Mouse
Conjugation HRP

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".